PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_21290V3.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2316aa    MW: 248436 Da    PI: 7.04
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_21290V3.6.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.1e-0911691212347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT  E el+ ++v+++G++ +++Ia ++g++++  qck ++ k 
  Pp3c12_21290V3.6.p 1169 QWTDRERELFTEGVRLFGKD-FERIAVHVGTTKSVGQCKAFFCKT 1212
                          5*****************99.*******************99886 PP

2Myb_DNA-binding34.16.5e-1114711512346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                          +WT+eE e+++d ++ +G++ W++  ++++  ++l q+k ++q+
  Pp3c12_21290V3.6.p 1471 SWTQEEKEKFADIIRNHGKD-WTRLHECLP-SKSLTQIKTYFQN 1512
                          7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.82E-13906969IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-4915962IPR009057Homeodomain-like
PROSITE profilePS5129317.276918969IPR017884SANT domain
SMARTSM007172.1E-7919967IPR001005SANT/Myb domain
PROSITE profilePS5129317.87811651217IPR017884SANT domain
SMARTSM007171.3E-811661215IPR001005SANT/Myb domain
SuperFamilySSF466892.24E-911691219IPR009057Homeodomain-like
PfamPF002498.2E-711691211IPR001005SANT/Myb domain
CDDcd001671.34E-511701211No hitNo description
SuperFamilySSF466892.58E-1014661516IPR009057Homeodomain-like
PROSITE profilePS512938.54214671518IPR017884SANT domain
SMARTSM007177.1E-914681516IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-714691513IPR009057Homeodomain-like
CDDcd001672.07E-614711514No hitNo description
PfamPF002493.0E-814711512IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2316 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHAS AWHREPYNRD ARLDRGDRER IIGGKREWNS  60
DRASFGAPYP RAFGGLHPVN GSLGPPNKRR LNGRHTGFHN EGGRYVSPGH RGEPPFGSVG  120
PVENGLGRKF DRESFYPGSG CPVGGSGFGN GVGVDQRAKE LEERHKKEPF LLLRDGRDGG  180
SCGGIEHGVR SFPSQAVCEA EKSCWERERS KGAVGNGWES SQKLQRDLRE RVGGKAEGYS  240
RREGKLSQHD GGREWSQADK ELEGRRVDGY GSSSRDGLTG DGVGGIKEAV GGCEWRRKER  300
SSSVSASRSG SYVASSGTAK GPVGRPQALD VSGSASSPQV SPHSTASPGV QEASRDDGSQ  360
PSPPKRPRLG WGQGLAKYEK KKVVETDEVG VSASGGSVSG RERSSVSGAT TEVVQTQESQ  420
AAEESPVSVV SNLSTLPPLT PSASPSQQAA EVVSKAMVEC DGVEQEVVGK VCERVAAEAE  480
AGGWISKPEG VVADDVEKRG NMRAVTECGL EESVRQGECC EALGLKESME CQASPKVRGS  540
VEHCGGVEVG GEVGVSDAGS RWAKEDILLR VEKVEYEIEE VERELAKAEK VGSDRRAAGE  600
WVAGVVGDEG SAGVDGVVKV EDGIDDGEAM DVDAAEVHPG RVDSRESGEA MQVACSGRNW  660
SGGEECGNGR WGSDGAGAAG NVGERVGGGV SEGGHGGSVD DGGVLEEEKE EAERKVISWD  720
VEVVARSLME ENKKRAEQAR ETFVHLLREG VGVEGTLYRC PAEAGVWKEN VERHYRNQER  780
MLEKMGERRQ SLRFAEQVLA MRFRALKEAW KQEQVGMRQQ QRGTKPVRRW EVEKRNGTAL  840
HCHRSSLRLR PVQAGMEKVE AVSEECMKKV MAKAVVGPVR GVLKMPSMIV GQENRLARRF  900
ESKNALVEDP VGMERERKSM NPWSWEEKRV FLEKFAVYNK NFSKIASHLE LKTTADCVEF  960
YYRNQKSEDF ERIRRRQQLK KRRDYSRVGG SFLSTGLQTS SQRREANGHG RTEGANVQTV  1020
GAVVGVSHIS VGTKAARSSM QQKPVERQRV SSALEPGSLP GAVEIGKGVS GKENKWCGTG  1080
GVSGSAAGRG GIFGMVLSGA TVSCGLSSAV AGAVKIGRER SSVKTMVDAG LVVASCGQIE  1140
QHVSAPMVTG NGYLQIYLEK SAGKEGDAQW TDRERELFTE GVRLFGKDFE RIAVHVGTTK  1200
SVGQCKAFFC KTRKRLGLDK LVEKYEDSLK VRVGAVMAES PECADVGRGE AAGVLAEDVR  1260
VSGLAVSAGP GMEVESDQDK GDESEKSVEV VLPVDVQEME AVEAEAEVSE DDRVEFVAVE  1320
KETFAEAVEV VVAKDGNTGN NSTDLAIGYV VEEDAAVIRK DAESDMESCK CEPDTGLVKA  1380
VGMLAKISTL AADEQEAKAV PTVDVKADPE SPQVATSLST DSASFPSLPA AVSHSGGSVF  1440
SNSSTQGSQQ GRERVGRVGG GETKSRREPT SWTQEEKEKF ADIIRNHGKD WTRLHECLPS  1500
KSLTQIKTYF QNSKAKLGLL NAEGVNILGG RVAGSRKRKV DEAEDGSNNV ACLSSGNELK  1560
GGGVSARDMD GVCQNVKAAV GGVPSMGMGS GPSGLESMLY PIFGQRVEDQ IALEKFMRMY  1620
SANGLAQNIA GGVNPFVQQY GFPMFPNAGH QRASQLSLQQ QLAASLAQKS GQAKGLQQQE  1680
LQGSGSVQQS GQMVRNQQLL ASMMQHQAAA HHQQNQTSKS VPHPLQPQFQ LALQHLQQQQ  1740
QQQQLQQHQH HQDQTQAQVQ VQAQAQIQAL EHSHSHSQSH IHQPQYSLAS LLQPLVVQKP  1800
KVVVPLPPQV TRTPSPPVLQ QGGLPHRHDQ HQHGPSHTFL RGNVASAVSS NPGEASTQQG  1860
EIGEQWGSIS HGGGSKERNF SRADLHQLSG AGQMVKPSNA EPSRPATESP QARIGDVKLF  1920
GQSLLSQPTS CAVSQNVARG SFSAAEKVSL QQSPVSTAVS SLATSMPVPA ASRVKPYGKE  1980
SAFRGVPFSS EGRQGGWPPL GNRGSMEMWN IMNNAHSQVG QVLKSKVEEL ELHNMQECRM  2040
SREAQDAESD QSTPKSTHKP QHLEQARGAQ DKSGSGGFSS LAYGVGKSRA CVNEHGVSSG  2100
EVSRTDPERR GESIGLDSGC SERSSMMASR SSRGQAESFA MQATGPFANG QQVPRTVIDA  2160
LMAIAELHRI RSSQFNSSVG QPRLEDHQWE SLVQHTTKGM AVDAVKANPS LSLNRPIATP  2220
QTHLRGNGVS QHCVRDSGLY FTQHYPNLPG QSGVVSSAWN GGTGLVHPCD VQRMLVNPAL  2280
SSFLPSALSR ASTATEKYLG SSEVRDSDGG RDGTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-15877971194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-15877971194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109160.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769009.10.0predicted protein
TrEMBLA9SRK80.0A9SRK8_PHYPA; Predicted protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.17e-35MYB family protein